PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02165.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 204aa    MW: 23668 Da    PI: 9.4228
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02165.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.3e-323993155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   k+r+rWt++LH+rFve+v++LGG+ekAtPk il++m v+gLt+ hvkSHLQkYR+
  Jcr4S02165.50 39 KTRIRWTKDLHKRFVECVNHLGGAEKATPKLILKMMAVEGLTIFHVKSHLQKYRM 93
                   68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-183793IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-293893IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-243993IPR006447Myb domain, plants
PfamPF002491.4E-84392IPR001005SANT/Myb domain
PfamPF143798.5E-20121168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MLETTMPKQQ ERLNFPGKQL KQQQSVYLVA SGSANIARKT RIRWTKDLHK RFVECVNHLG  60
GAEKATPKLI LKMMAVEGLT IFHVKSHLQK YRMCRYIPES TEGKSERNST NDISIDQKTG  120
MQIAETLKLQ LVVQRRLHEQ LEIQRNLQLR IEEQGRQLKN MLDQQRKTNN TDLSETTNSD  180
FTFQEDIPSN GLHSSPVEEL EDSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092628.11e-136PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN55e-46PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A067J9G21e-136A0A067J9G2_JATCU; Uncharacterized protein
STRINGPOPTR_0006s20540.12e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-62G2-like family protein